SCOPe 2.08: Domain d1xiub_: 1xiu B:

Lineage for d1xiub_ (1xiu B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Biomphalaria glabrata [TaxId:6526] [188120] (1 PDB entry)

8. Domain d1xiub_: 1xiu B: [162080]
   automated match to d1lbda_
   complexed with 9cr

Details for d1xiub_

PDB Entry: 1xiu, 2.5 Å

PDB Description: crystal structure of the agonist-bound ligand-binding domain of biomphalaria glabrata rxr

PDB Compounds: (B:) RXR-like protein

SCOPe Domain Sequences for d1xiub_:

Sequence; same for both SEQRES and ATOM records:

>d1xiub_ a.123.1.1 (B:) automated matches {Biomphalaria glabrata [TaxId: 6526]}
nndmpveqileaelavdpkidtyidaqkdpvtnicqaadkqlftlvewakriphftelpl
edqvillragwnelliagfshrsimakdgillatglhvhrssahqagvgtifdrvltelv
akmrdmkmdktelgclravvlfnpdakgltavqeveqlrekvyasleeytksrypeepgr
faklllrlpalrsiglkclehlfffkligdqpidtflmemlenp

Timeline for d1xiub_:

• d1xiub_ first appeared in SCOPe 2.01
  
• d1xiub_ appears in SCOPe 2.07