Lineage for d1ddnb1 (1ddn B:3-64)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693576Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2693577Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 2693578Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
    Uniprot P33120
  8. 2693603Domain d1ddnb1: 1ddn B:3-64 [16208]
    Other proteins in same PDB: d1ddna2, d1ddnb2, d1ddnc2, d1ddnd2
    protein/DNA complex; complexed with ni; mutant

Details for d1ddnb1

PDB Entry: 1ddn (more details), 3 Å

PDB Description: diphtheria tox repressor (c102d mutant)/tox dna operator complex
PDB Compounds: (B:) diphtheria tox repressor

SCOPe Domain Sequences for d1ddnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddnb1 a.4.5.24 (B:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm

SCOPe Domain Coordinates for d1ddnb1:

Click to download the PDB-style file with coordinates for d1ddnb1.
(The format of our PDB-style files is described here.)

Timeline for d1ddnb1: