Lineage for d1xiua_ (1xiu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729643Species Biomphalaria glabrata [TaxId:6526] [188120] (1 PDB entry)
  8. 2729644Domain d1xiua_: 1xiu A: [162079]
    automated match to d1lbda_
    complexed with 9cr

Details for d1xiua_

PDB Entry: 1xiu (more details), 2.5 Å

PDB Description: crystal structure of the agonist-bound ligand-binding domain of biomphalaria glabrata rxr
PDB Compounds: (A:) RXR-like protein

SCOPe Domain Sequences for d1xiua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiua_ a.123.1.1 (A:) automated matches {Biomphalaria glabrata [TaxId: 6526]}
ndmpveqileaelavdpkidtyidaqkdpvtnicqaadkqlftlvewakriphftelple
dqvillragwnelliagfshrsimakdgillatglhvhrssahqagvgtifdrvltelva
kmrdmkmdktelgclravvlfnpdakgltavqeveqlrekvyasleeytksrypeepgrf
aklllrlpalrsiglkclehlfffkligdqpidtflmemle

SCOPe Domain Coordinates for d1xiua_:

Click to download the PDB-style file with coordinates for d1xiua_.
(The format of our PDB-style files is described here.)

Timeline for d1xiua_: