SCOPe 2.01: Domain d1xh9a_: 1xh9 A:

Lineage for d1xh9a_ (1xh9 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (39 PDB entries)
   Uniprot P00517

8. Domain d1xh9a_: 1xh9 A: [162076]
   automated match to d1cmke_
   complexed with bu3, r69; mutant

Details for d1xh9a_

PDB Entry: 1xh9, 1.64 Å

PDB Description: crystal structures of protein kinase b selective inhibitors in complex with protein kinase a and mutants

PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d1xh9a_:

Sequence; same for both SEQRES and ATOM records:

>d1xh9a_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
esvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamk
ildkqkvvklkeiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyapggemfshl
rrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyikvtdfglakrvk
grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
pfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d1xh9a_:

• d1xh9a_ is new in SCOPe 2.01-stable
  
• d1xh9a_ appears in SCOPe 2.02
  
• d1xh9a_ appears in the current release, SCOPe 2.08