Lineage for d1xgva_ (1xgv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906256Species Aeropyrum pernix [TaxId:56636] [188025] (3 PDB entries)
  8. 2906261Domain d1xgva_: 1xgv A: [162074]
    automated match to d1hqsa_

Details for d1xgva_

PDB Entry: 1xgv (more details), 2.2 Å

PDB Description: isocitrate dehydrogenase from the hyperthermophile aeropyrum pernix
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d1xgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgva_ c.77.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 56636]}
sppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkv
yggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrslnvai
rqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrfl
aeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafm
rwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqviva
pnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsas
lligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayidead
lnevlagkrg

SCOPe Domain Coordinates for d1xgva_:

Click to download the PDB-style file with coordinates for d1xgva_.
(The format of our PDB-style files is described here.)

Timeline for d1xgva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xgvb_