Lineage for d1ddna1 (1ddn A:3-64)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1639Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)
  6. 1640Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 1641Species Corynebacterium diphtheriae [TaxId:1717] [46884] (10 PDB entries)
  8. 1654Domain d1ddna1: 1ddn A:3-64 [16207]
    Other proteins in same PDB: d1ddna2, d1ddnb2, d1ddnc2, d1ddnd2

Details for d1ddna1

PDB Entry: 1ddn (more details), 3 Å

PDB Description: diphtheria tox repressor (c102d mutant)/tox dna operator complex

SCOP Domain Sequences for d1ddna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddna1 a.4.5.24 (A:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm

SCOP Domain Coordinates for d1ddna1:

Click to download the PDB-style file with coordinates for d1ddna1.
(The format of our PDB-style files is described here.)

Timeline for d1ddna1: