Lineage for d1xg2b1 (1xg2 B:1-150)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708802Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 2708834Family a.29.6.0: automated matches [191503] (1 protein)
    not a true family
  6. 2708835Protein automated matches [190825] (1 species)
    not a true protein
  7. 2708836Species Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId:3625] [188117] (1 PDB entry)
  8. 2708837Domain d1xg2b1: 1xg2 B:1-150 [162063]
    Other proteins in same PDB: d1xg2a_, d1xg2b2
    automated match to d1x90a_

Details for d1xg2b1

PDB Entry: 1xg2 (more details), 1.9 Å

PDB Description: Crystal structure of the complex between pectin methylesterase and its inhibitor protein
PDB Compounds: (B:) Pectinesterase inhibitor

SCOPe Domain Sequences for d1xg2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg2b1 a.29.6.0 (B:1-150) automated matches {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]}
enhliseicpktrnpslclqalesdprsaskdlkglgqfsidiaqasakqtskiiasltn
qatdpklkgryetcsenyadaidslgqakqfltsgdynslniyasaafdgagtcedsfeg
ppniptqlhqadlkledlcdivlvisnllp

SCOPe Domain Coordinates for d1xg2b1:

Click to download the PDB-style file with coordinates for d1xg2b1.
(The format of our PDB-style files is described here.)

Timeline for d1xg2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xg2b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xg2a_