![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) ![]() contains a short alpha-hairpin at the N-terminal extension |
![]() | Family a.29.6.0: automated matches [191503] (1 protein) not a true family |
![]() | Protein automated matches [190825] (1 species) not a true protein |
![]() | Species Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId:3625] [188117] (1 PDB entry) |
![]() | Domain d1xg2b1: 1xg2 B:1-150 [162063] Other proteins in same PDB: d1xg2a_, d1xg2b2 automated match to d1x90a_ |
PDB Entry: 1xg2 (more details), 1.9 Å
SCOPe Domain Sequences for d1xg2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xg2b1 a.29.6.0 (B:1-150) automated matches {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} enhliseicpktrnpslclqalesdprsaskdlkglgqfsidiaqasakqtskiiasltn qatdpklkgryetcsenyadaidslgqakqfltsgdynslniyasaafdgagtcedsfeg ppniptqlhqadlkledlcdivlvisnllp
Timeline for d1xg2b1: