SCOPe 2.06: Domain d1f5td1: 1f5t D:4002-4064

Lineage for d1f5td1 (1f5t D:4002-4064)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
   Uniprot P33120

8. Domain d1f5td1: 1f5t D:4002-4064 [16206]
   Other proteins in same PDB: d1f5ta2, d1f5tb2, d1f5tc2, d1f5td2
   protein/DNA complex; complexed with ni; mutant

Details for d1f5td1

PDB Entry: 1f5t, 3 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence

PDB Compounds: (D:) diphtheria toxin repressor

SCOPe Domain Sequences for d1f5td1:

Sequence; same for both SEQRES and ATOM records:

>d1f5td1 a.4.5.24 (D:4002-4064) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
lqm

Timeline for d1f5td1:

• d1f5td1 first appeared (with stable ids) in SCOP 1.55
  
• d1f5td1 appears in SCOPe 2.05
  
• d1f5td1 appears in SCOPe 2.07
  
• d1f5td1 appears in the current release, SCOPe 2.08