SCOPe 2.08: Domain d1xd8b_: 1xd8 B:

Lineage for d1xd8b_ (1xd8 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (26 PDB entries)

8. Domain d1xd8b_: 1xd8 B: [162057]
   automated match to d1de0a_
   complexed with sf4

Details for d1xd8b_

PDB Entry: 1xd8, 2.7 Å

PDB Description: crystal structure of the nitrogenase fe protein asp39asn

PDB Compounds: (B:) nitrogenase iron protein 1

SCOPe Domain Sequences for d1xd8b_:

Sequence; same for both SEQRES and ATOM records:

>d1xd8b_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcnpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

Timeline for d1xd8b_:

• d1xd8b_ first appeared in SCOPe 2.01
  
• d1xd8b_ appears in SCOPe 2.07