Lineage for d1x9ub_ (1x9u B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. Protein automated matches [190824] (31 species)
    not a true protein
  7. Species Horseradish (Armoracia rusticana) [TaxId:3704] [188115] (2 PDB entries)
  8. Domain d1x9ub_: 1x9u B: [162054]
    automated match to d1jera_
    complexed with cu

Details for d1x9ub_

PDB Entry: 1x9u (more details), 1.8 Å

PDB Description: Umecyanin from Horse Raddish- Crystal Structure of the reduced form
PDB Compounds: (B:) Umecyanin

SCOPe Domain Sequences for d1x9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9ub_ b.6.1.0 (B:) automated matches {Horseradish (Armoracia rusticana) [TaxId: 3704]}
medydvggdmewkrpsdpkfyitwatgktfrvgdelefdfaagmhdvavvtkdafdnckk
enpishmttppvkimlnttgpqyyictvgdhcrvgqklsinvvg

SCOPe Domain Coordinates for d1x9ub_ are not available.

Timeline for d1x9ub_:

Domains from other chains:
(mouse over for more information)
d1x9ua_