Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (3 species) not a true protein |
Species Horseradish (Armoracia rusticana) [TaxId:3704] [188115] (2 PDB entries) |
Domain d1x9rb_: 1x9r B: [162052] automated match to d1jera_ complexed with cu |
PDB Entry: 1x9r (more details), 1.9 Å
SCOPe Domain Sequences for d1x9rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9rb_ b.6.1.0 (B:) automated matches {Horseradish (Armoracia rusticana) [TaxId: 3704]} medydvggdmewkrpsdpkfyitwatgktfrvgdelefdfaagmhdvavvtkdafdnckk enpishmttppvkimlnttgpqyyictvgdhcrvgqklsinvvg
Timeline for d1x9rb_: