SCOPe 2.08: Domain d1x9rb_: 1x9r B:

Lineage for d1x9rb_ (1x9r B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Horseradish (Armoracia rusticana) [TaxId:3704] [188115] (2 PDB entries)

8. Domain d1x9rb_: 1x9r B: [162052]
   automated match to d1jera_
   complexed with cu

Details for d1x9rb_

PDB Entry: 1x9r, 1.9 Å

PDB Description: Umecyanin from Horse Raddish- Crystal Structure of the oxidised form

PDB Compounds: (B:) Umecyanin

SCOPe Domain Sequences for d1x9rb_:

Sequence; same for both SEQRES and ATOM records:

>d1x9rb_ b.6.1.0 (B:) automated matches {Horseradish (Armoracia rusticana) [TaxId: 3704]}
medydvggdmewkrpsdpkfyitwatgktfrvgdelefdfaagmhdvavvtkdafdnckk
enpishmttppvkimlnttgpqyyictvgdhcrvgqklsinvvg

Timeline for d1x9rb_:

• d1x9rb_ first appeared in SCOPe 2.01
  
• d1x9rb_ appears in SCOPe 2.07