Lineage for d1x9ra_ (1x9r A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772470Species Horseradish (Armoracia rusticana) [TaxId:3704] [188115] (2 PDB entries)
  8. 2772473Domain d1x9ra_: 1x9r A: [162051]
    automated match to d1jera_
    complexed with cu

Details for d1x9ra_

PDB Entry: 1x9r (more details), 1.9 Å

PDB Description: Umecyanin from Horse Raddish- Crystal Structure of the oxidised form
PDB Compounds: (A:) Umecyanin

SCOPe Domain Sequences for d1x9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9ra_ b.6.1.0 (A:) automated matches {Horseradish (Armoracia rusticana) [TaxId: 3704]}
medydvggdmewkrpsdpkfyitwatgktfrvgdelefdfaagmhdvavvtkdafdnckk
enpishmttppvkimlnttgpqyyictvgdhcrvgqklsinvvga

SCOPe Domain Coordinates for d1x9ra_:

Click to download the PDB-style file with coordinates for d1x9ra_.
(The format of our PDB-style files is described here.)

Timeline for d1x9ra_: