Lineage for d1x8xa_ (1x8x A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160658Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1160659Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1160660Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1160871Protein automated matches [190581] (6 species)
    not a true protein
  7. 1160875Species Escherichia coli [TaxId:562] [188048] (3 PDB entries)
  8. 1160876Domain d1x8xa_: 1x8x A: [162050]
    automated match to d1tyae_
    protein/RNA complex; complexed with so4, tyr

Details for d1x8xa_

PDB Entry: 1x8x (more details), 2 Å

PDB Description: Tyrosyl t-RNA Synthetase from E.coli Complexed with Tyrosine
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1x8xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8xa_ c.26.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
massnlikqlqerglvaqvtdeealaerlaqgpialycgfdptadslhlghlvpllclkr
fqqaghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgens
aiaannydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqg
ydfaclnkqygvvlqiggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkte
ggavwldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraq
yvlaeqvtrlvhgeeglqaakr

SCOPe Domain Coordinates for d1x8xa_:

Click to download the PDB-style file with coordinates for d1x8xa_.
(The format of our PDB-style files is described here.)

Timeline for d1x8xa_: