Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein automated matches [190581] (6 species) not a true protein |
Species Escherichia coli [TaxId:562] [188048] (3 PDB entries) |
Domain d1x8xa_: 1x8x A: [162050] automated match to d1tyae_ protein/RNA complex; complexed with so4, tyr |
PDB Entry: 1x8x (more details), 2 Å
SCOPe Domain Sequences for d1x8xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x8xa_ c.26.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} massnlikqlqerglvaqvtdeealaerlaqgpialycgfdptadslhlghlvpllclkr fqqaghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgens aiaannydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqg ydfaclnkqygvvlqiggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkte ggavwldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraq yvlaeqvtrlvhgeeglqaakr
Timeline for d1x8xa_: