Lineage for d1f5tc1 (1f5t C:3002-3064)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1639Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)
  6. 1640Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 1641Species Corynebacterium diphtheriae [TaxId:1717] [46884] (10 PDB entries)
  8. 1652Domain d1f5tc1: 1f5t C:3002-3064 [16205]
    Other proteins in same PDB: d1f5ta2, d1f5tb2, d1f5tc2, d1f5td2

Details for d1f5tc1

PDB Entry: 1f5t (more details), 3 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence

SCOP Domain Sequences for d1f5tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5tc1 a.4.5.24 (C:3002-3064) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
lqm

SCOP Domain Coordinates for d1f5tc1:

Click to download the PDB-style file with coordinates for d1f5tc1.
(The format of our PDB-style files is described here.)

Timeline for d1f5tc1: