Lineage for d1x8lb_ (1x8l B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866454Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2866543Protein automated matches [190189] (4 species)
    not a true protein
  7. 2866544Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [188114] (3 PDB entries)
  8. 2866546Domain d1x8lb_: 1x8l B: [162049]
    automated match to d1fmja_
    complexed with a3p, ca, hg, oxr

Details for d1x8lb_

PDB Entry: 1x8l (more details), 2.1 Å

PDB Description: crystal structure of retinol dehydratase in complex with all-trans-4- oxoretinol and inactive cofactor pap
PDB Compounds: (B:) retinol dehydratase

SCOPe Domain Sequences for d1x8lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8lb_ c.37.1.5 (B:) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
pfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdvf
vasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpnp
enldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylardp
rdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlflf
yedylkdlpgsiariadflgkklseeqiqrlsehlnfekfknngavnmedyreigiladg
ehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm

SCOPe Domain Coordinates for d1x8lb_:

Click to download the PDB-style file with coordinates for d1x8lb_.
(The format of our PDB-style files is described here.)

Timeline for d1x8lb_: