SCOPe 2.05: Domain d1x8ka_: 1x8k A:

Lineage for d1x8ka_ (1x8k A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
   Pfam PF00685
   similar to the nucleotide/nucleoside kinases but transfer sulphate group

6. Protein automated matches [190189] (4 species)
   not a true protein

7. Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [188114] (3 PDB entries)

8. Domain d1x8ka_: 1x8k A: [162046]
   automated match to d1fmja_
   complexed with a3p, anr, ca, emc

Details for d1x8ka_

PDB Entry: 1x8k, 2.75 Å

PDB Description: crystal structure of retinol dehydratase in complex with anhydroretinol and inactive cofactor pap

PDB Compounds: (A:) retinol dehydratase

SCOPe Domain Sequences for d1x8ka_:

Sequence; same for both SEQRES and ATOM records:

>d1x8ka_ c.37.1.5 (A:) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
dlpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptd
vfvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilp
npenldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylar
dprdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlf
lfyedylkdlpgsiariadflgkklseeqiqrlsehlnfekfknngavnmedyreigila
dgehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm

Timeline for d1x8ka_:

• d1x8ka_ first appeared in SCOPe 2.01
  
• d1x8ka_ appears in SCOPe 2.04
  
• d1x8ka_ appears in SCOPe 2.06
  
• d1x8ka_ appears in the current release, SCOPe 2.08