Lineage for d1x7ea_ (1x7e A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008578Protein Estrogen receptor alpha [48519] (1 species)
  7. 2008579Species Human (Homo sapiens) [TaxId:9606] [48520] (64 PDB entries)
    Uniprot P03372 307-551
  8. 2008683Domain d1x7ea_: 1x7e A: [162037]
    automated match to d1g50a_
    complexed with 244

Details for d1x7ea_

PDB Entry: 1x7e (more details), 2.8 Å

PDB Description: crystal structure of estrogen receptor alpha complexed with way-244
PDB Compounds: (A:) Estrogen receptor 1 (alpha)

SCOPe Domain Sequences for d1x7ea_:

Sequence, based on SEQRES records: (download)

>d1x7ea_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpvkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
dahrl

Sequence, based on observed residues (ATOM records): (download)

>d1x7ea_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpvkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytfleekdhihrvldkitdtlihlma
kagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahrl

SCOPe Domain Coordinates for d1x7ea_:

Click to download the PDB-style file with coordinates for d1x7ea_.
(The format of our PDB-style files is described here.)

Timeline for d1x7ea_: