Lineage for d1x46a_ (1x46 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689580Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries)
  8. 2689581Domain d1x46a_: 1x46 A: [162036]
    automated match to d1ecaa_
    complexed with hem

Details for d1x46a_

PDB Entry: 1x46 (more details), 1.5 Å

PDB Description: Crystal structure of a hemoglobin component (TA-VII) from Tokunagayusurika akamusi
PDB Compounds: (A:) hemoglobin component VII

SCOPe Domain Sequences for d1x46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x46a_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}
dptwvdmeagdialvksswaqihdkevdilynffksypasqakfsafagkdleslkdtap
falhatrivsvineaialmgvaenrpalknvlkqqginhkgrgvtaahfeefetaleafl
eshasgynagtkkawdsafnnmysvvfpel

SCOPe Domain Coordinates for d1x46a_:

Click to download the PDB-style file with coordinates for d1x46a_.
(The format of our PDB-style files is described here.)

Timeline for d1x46a_: