Lineage for d1x3la_ (1x3l A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150479Fold c.118: GckA/TtuD-like [82543] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456, Rossmann-like topology
    Domain 2 has mixed sheet of 6 strands, order 126345; strands 5 and 6 are antiparallel to the rest; some similarity to CbiF Domain 2
  4. 2150480Superfamily c.118.1: GckA/TtuD-like [82544] (2 families) (S)
  5. 2150488Family c.118.1.0: automated matches [191501] (1 protein)
    not a true family
  6. 2150489Protein automated matches [190823] (1 species)
    not a true protein
  7. 2150490Species Pyrococcus horikoshii OT3 [TaxId:70601] [188111] (1 PDB entry)
  8. 2150491Domain d1x3la_: 1x3l A: [162032]
    automated match to d2b8na1
    complexed with edo, so4

Details for d1x3la_

PDB Entry: 1x3l (more details), 2.1 Å

PDB Description: Crystal structure of the PH0495 protein from pyrococccus horikoshii OT3
PDB Compounds: (A:) hypothetical protein PH0495

SCOPe Domain Sequences for d1x3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3la_ c.118.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
miamdireiglrlvgeaikaadpyravlnavkvsddkiivqgkefeikgkvyvialgkaa
cemaraiedildvedgvavtkygygkelkrikvieaghpipdeksilgakealsilnrar
endivfilisgggsalfelpeegisledlklttdlllksgakiheintvrkhiskvkggk
lakmikgtgivliisdvvgdnleaiasgptvkdpttfedakrilelydiwekvpesvrlh
ierglrgeveetlkedlpnvhnfliasnsisceaiareaqrlgfkayimtttlegeakda
glfigsivqeiaergrpfeppvvlvfggettvtiegkggkggpnqeialsatrkisdlea
livafdtdgtdgptdaaggivdgttykklrekgidvekvlkehnsyealkkvggllftgp
tgtnvnsiviaivtsk

SCOPe Domain Coordinates for d1x3la_:

Click to download the PDB-style file with coordinates for d1x3la_.
(The format of our PDB-style files is described here.)

Timeline for d1x3la_: