Class b: All beta proteins [48724] (176 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins) |
Protein automated matches [190821] (2 species) not a true protein |
Species SMV (Sesbania mosaic virus) [TaxId:12558] [188106] (1 PDB entry) |
Domain d1x36a_: 1x36 A: [162031] automated match to d1smvc_ complexed with ca; mutant |
PDB Entry: 1x36 (more details), 2.7 Å
SCOPe Domain Sequences for d1x36a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x36a_ b.121.4.7 (A:) automated matches {SMV (Sesbania mosaic virus) [TaxId: 12558]} rggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyips cpsstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtsta isttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagri yctytiqmieptasalnn
Timeline for d1x36a_: