Lineage for d1x36a_ (1x36 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141359Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1141532Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1141948Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 1141987Protein automated matches [190821] (2 species)
    not a true protein
  7. 1141991Species SMV (Sesbania mosaic virus) [TaxId:12558] [188106] (1 PDB entry)
  8. 1141992Domain d1x36a_: 1x36 A: [162031]
    automated match to d1smvc_
    complexed with ca; mutant

Details for d1x36a_

PDB Entry: 1x36 (more details), 2.7 Å

PDB Description: T=1 capsid of an amino-terminal deletion mutant of SeMV CP
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d1x36a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x36a_ b.121.4.7 (A:) automated matches {SMV (Sesbania mosaic virus) [TaxId: 12558]}
rggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyips
cpsstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtsta
isttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagri
yctytiqmieptasalnn

SCOPe Domain Coordinates for d1x36a_:

Click to download the PDB-style file with coordinates for d1x36a_.
(The format of our PDB-style files is described here.)

Timeline for d1x36a_: