SCOPe 2.06: Domain d1x1vb_: 1x1v B:

Lineage for d1x1vb_ (1x1v B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.0: automated matches [191397] (1 protein)
   not a true family

6. Protein automated matches [190516] (4 species)
   not a true protein

7. Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)

8. Domain d1x1vb_: 1x1v B: [162030]
   automated match to d1c3ka_
   complexed with hez, mma, zn

Details for d1x1vb_

PDB Entry: 1x1v, 2.45 Å

PDB Description: structure of banana lectin- methyl-alpha-mannose complex

PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d1x1vb_:

Sequence; same for both SEQRES and ATOM records:

>d1x1vb_ b.77.3.0 (B:) automated matches {Musa acuminata [TaxId: 4641]}
ngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggt
pheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagki
sgffgrggdfidaigvylep

Timeline for d1x1vb_:

• d1x1vb_ first appeared in SCOPe 2.01
  
• d1x1vb_ appears in SCOPe 2.05
  
• d1x1vb_ appears in SCOPe 2.07
  
• d1x1vb_ appears in the current release, SCOPe 2.08