Lineage for d1x1vb_ (1x1v B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1137196Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1137214Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 1137330Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 1137331Protein automated matches [190516] (2 species)
    not a true protein
  7. 1137334Species Musa acuminata [TaxId:4641] [187471] (6 PDB entries)
  8. 1137338Domain d1x1vb_: 1x1v B: [162030]
    automated match to d1c3ka_
    complexed with hez, mma, zn

Details for d1x1vb_

PDB Entry: 1x1v (more details), 2.45 Å

PDB Description: structure of banana lectin- methyl-alpha-mannose complex
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d1x1vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1vb_ b.77.3.0 (B:) automated matches {Musa acuminata [TaxId: 4641]}
ngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggt
pheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagki
sgffgrggdfidaigvylep

SCOPe Domain Coordinates for d1x1vb_:

Click to download the PDB-style file with coordinates for d1x1vb_.
(The format of our PDB-style files is described here.)

Timeline for d1x1vb_: