![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.0: automated matches [191397] (1 protein) not a true family |
![]() | Protein automated matches [190516] (1 species) not a true protein |
![]() | Species Musa acuminata [TaxId:4641] [187471] (6 PDB entries) |
![]() | Domain d1x1vb_: 1x1v B: [162030] automated match to d1c3ka_ complexed with hez, mma, zn |
PDB Entry: 1x1v (more details), 2.45 Å
SCOPe Domain Sequences for d1x1vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1vb_ b.77.3.0 (B:) automated matches {Musa acuminata [TaxId: 4641]} ngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggt pheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagki sgffgrggdfidaigvylep
Timeline for d1x1vb_: