Lineage for d1f5ta1 (1f5t A:1002-1064)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 438851Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)
  6. 438852Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 438853Species Corynebacterium diphtheriae [TaxId:1717] [46884] (16 PDB entries)
  8. 438869Domain d1f5ta1: 1f5t A:1002-1064 [16203]
    Other proteins in same PDB: d1f5ta2, d1f5tb2, d1f5tc2, d1f5td2

Details for d1f5ta1

PDB Entry: 1f5t (more details), 3 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence

SCOP Domain Sequences for d1f5ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5ta1 a.4.5.24 (A:1002-1064) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
lqm

SCOP Domain Coordinates for d1f5ta1:

Click to download the PDB-style file with coordinates for d1f5ta1.
(The format of our PDB-style files is described here.)

Timeline for d1f5ta1: