Lineage for d1x12a_ (1x12 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889399Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2889400Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
    automatically mapped to Pfam PF01470
  6. 2889401Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 2889415Species Pyrococcus furiosus [TaxId:2261] [64099] (7 PDB entries)
  8. 2889416Domain d1x12a_: 1x12 A: [162024]
    automated match to d1ioia_
    mutant

Details for d1x12a_

PDB Entry: 1x12 (more details), 2 Å

PDB Description: structure of mutant pyrrolidone carboxyl peptidase (e192d) from a hyperthermophile, pyrococcus furiosus
PDB Compounds: (A:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d1x12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x12a_ c.56.4.1 (A:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Pyrococcus furiosus [TaxId: 2261]}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmsyemdleavkvaievaleell

SCOPe Domain Coordinates for d1x12a_:

Click to download the PDB-style file with coordinates for d1x12a_.
(The format of our PDB-style files is described here.)

Timeline for d1x12a_: