Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) |
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins) automatically mapped to Pfam PF01470 |
Protein automated matches [190601] (1 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [187619] (2 PDB entries) |
Domain d1x10c_: 1x10 C: [162022] automated match to d1iofa_ mutant |
PDB Entry: 1x10 (more details), 2 Å
SCOPe Domain Sequences for d1x10c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x10c_ c.56.4.1 (C:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk gqvppsmsyemaleavkvaievaleell
Timeline for d1x10c_: