SCOPe 2.05: Domain d1x10b_: 1x10 B:

Lineage for d1x10b_ (1x10 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families)

5. Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
   automatically mapped to Pfam PF01470

6. Protein automated matches [190601] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [187619] (2 PDB entries)

8. Domain d1x10b_: 1x10 B: [162021]
   automated match to d1iofa_
   mutant

Details for d1x10b_

PDB Entry: 1x10, 2 Å

PDB Description: structure of mutant pyrrolidone carboxyl peptidase (e192a) from a hyperthermophile, pyrococcus furiosus

PDB Compounds: (B:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d1x10b_:

Sequence; same for both SEQRES and ATOM records:

>d1x10b_ c.56.4.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmsyemaleavkvaievaleell

Timeline for d1x10b_:

• d1x10b_ first appeared in SCOPe 2.01
  
• d1x10b_ appears in SCOPe 2.04
  
• d1x10b_ appears in SCOPe 2.06
  
• d1x10b_ appears in the current release, SCOPe 2.08