Lineage for d1x0la_ (1x0l A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906425Species Thermus thermophilus [TaxId:274] [188105] (1 PDB entry)
  8. 2906426Domain d1x0la_: 1x0l A: [162018]
    automated match to d1wpwa_

Details for d1x0la_

PDB Entry: 1x0l (more details), 1.85 Å

PDB Description: Crystal structure of tetrameric homoisocitrate dehydrogenase from an extreme thermophile, Thermus thermophilus
PDB Compounds: (A:) Homoisocitrate dehydrogenase

SCOPe Domain Sequences for d1x0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0la_ c.77.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
ayricliegdgighevipaarrvleatglplefveaeagwetferrgtsvpeetvekils
chatlfgaatsptrkvpgffgairylrrrldlyanvrpaksrpvpgsrpgvdlvivrent
eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
fldtvkevakdfplvnvqdiivdncamqlvmrperfdvivttnllgdilsdlaaglvggl
glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
dlvlergprtpdlggdatteafteavvealksl

SCOPe Domain Coordinates for d1x0la_:

Click to download the PDB-style file with coordinates for d1x0la_.
(The format of our PDB-style files is described here.)

Timeline for d1x0la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x0lb_