SCOPe 2.06: Domain d1x08a_: 1x08 A:

Lineage for d1x08a_ (1x08 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein automated matches [190121] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186844] (9 PDB entries)

8. Domain d1x08a_: 1x08 A: [162013]
   automated match to d1jp3a_
   complexed with fps, ipe; mutant

Details for d1x08a_

PDB Entry: 1x08, 1.9 Å

PDB Description: crystal structure of d26a mutant upps in complex with mg, ipp and fspp

PDB Compounds: (A:) Undecaprenyl pyrophosphate synthetase

SCOPe Domain Sequences for d1x08a_:

Sequence; same for both SEQRES and ATOM records:

>d1x08a_ c.101.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimagngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
enwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealta
gntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlv
irtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Timeline for d1x08a_:

• d1x08a_ first appeared in SCOPe 2.01
  
• d1x08a_ appears in SCOPe 2.05
  
• d1x08a_ appears in SCOPe 2.07
  
• d1x08a_ appears in the current release, SCOPe 2.08