Lineage for d1wz9b_ (1wz9 B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. Protein automated matches [190484] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188559] (24 PDB entries)
  8. Domain d1wz9b_: 1wz9 B: [162011]
    automated match to d1xqga_
    complexed with so4

Details for d1wz9b_

PDB Entry: 1wz9 (more details), 2.1 Å

PDB Description: the 2.1 a structure of a tumour suppressing serpin
PDB Compounds: (B:) Maspin precursor

SCOPe Domain Sequences for d1wz9b_:

Sequence, based on SEQRES records: (download)

>d1wz9b_ e.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlhf
envkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletvd
fkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkfpeset
kecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvedes
tglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifsed
tsdfsgmsetkgvalsnvihkvcleitedggdsievpgarilqhkdelnadhpfiyiirh
nktrniiffgkfcsp

Sequence, based on observed residues (ATOM records): (download)

>d1wz9b_ e.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlhf
envkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletvd
fkdkleetkgqinnsikdltdghfenilasvndqtkilvvnaayfvgkwmkkfpesetke
cpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvtgleki
ekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifsedtsdfsg
msetkgvalsnvihkvcleitedggdslqhkdelnadhpfiyiirhnktrniiffgkfcs
p

SCOPe Domain Coordinates for d1wz9b_ are not available.

Timeline for d1wz9b_:

Domains from other chains:
(mouse over for more information)
d1wz9a_