SCOPe 2.07: Domain d2tdxa1: 2tdx A:1-64

Lineage for d2tdxa1 (2tdx A:1-64)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
   Uniprot P33120

8. Domain d2tdxa1: 2tdx A:1-64 [16201]
   Other proteins in same PDB: d2tdxa2
   protein/DNA complex; complexed with ni; mutant

Details for d2tdxa1

PDB Entry: 2tdx, 2.4 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel

PDB Compounds: (A:) diphtheria tox repressor

SCOPe Domain Sequences for d2tdxa1:

Sequence; same for both SEQRES and ATOM records:

>d2tdxa1 a.4.5.24 (A:1-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
slqm

Timeline for d2tdxa1:

• d2tdxa1 first appeared (with stable ids) in SCOP 1.55, called d2tdx_1
  
• d2tdxa1 appears in SCOPe 2.06
  
• d2tdxa1 appears in the current release, SCOPe 2.08