SCOP 1.57: Domain d2tdx_1: 2tdx 1-64

Lineage for d2tdx_1 (2tdx 1-64)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families)

5. Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (11 PDB entries)

8. Domain d2tdx_1: 2tdx 1-64 [16201]
   Other proteins in same PDB: d2tdx_2

Details for d2tdx_1

PDB Entry: 2tdx, 2.4 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel

SCOP Domain Sequences for d2tdx_1:

Sequence; same for both SEQRES and ATOM records:

>d2tdx_1 a.4.5.24 (1-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
slqm

Timeline for d2tdx_1:

• d2tdx_1 first appeared (with stable ids) in SCOP 1.55
  
• d2tdx_1 appears in SCOP 1.59
  
• d2tdx_1 appears in the current release, SCOPe 2.08, called d2tdxa1