Lineage for d2tdx_1 (2tdx 1-64)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) 
Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins) Protein Diphtheria toxin repressor (DtxR) [46883] (1 species) Species Corynebacterium diphtheriae [TaxId:1717] [46884] (10 PDB entries) 
Domain d2tdx_1: 2tdx 1-64 [16201]
Other proteins in same PDB: d2tdx_2
Details for d2tdx_1
PDB Entry: 2tdx (more details), 2.4 Å
PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel
SCOP Domain Sequences for d2tdx_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tdx_1 a.4.5.24 (1-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
slqm
SCOP Domain Coordinates for d2tdx_1:
Click to download the PDB-style file with coordinates for d2tdx_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tdx_1:
- d2tdx_1 appears in SCOP 1.57
- d2tdx_1 appears in the current release, SCOPe 2.08, called d2tdxa1
View in 3D
