SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2tdxa1 (2tdx A:1-64)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982775Family a.4.5.24: Iron-dependent repressor protein [46882] (4 protein domains)
    automatically mapped to Pfam PF01325
  6. 1982776Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 1982777Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
    Uniprot P33120
  8. 1982795Domain d2tdxa1: 2tdx A:1-64 [16201]
    Other proteins in same PDB: d2tdxa2
    protein/DNA complex; complexed with ni; mutant

Details for d2tdxa1

PDB Entry: 2tdx (more details), 2.4 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel
PDB Compounds: (A:) diphtheria tox repressor

SCOPe Domain Sequences for d2tdxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tdxa1 a.4.5.24 (A:1-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
slqm

SCOPe Domain Coordinates for d2tdxa1:

Click to download the PDB-style file with coordinates for d2tdxa1.
(The format of our PDB-style files is described here.)

Timeline for d2tdxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2tdxa2