Lineage for d2tdxa1 (2tdx A:1-64)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693576Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2693577Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 2693578Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
    Uniprot P33120
  8. 2693592Domain d2tdxa1: 2tdx A:1-64 [16201]
    Other proteins in same PDB: d2tdxa2
    protein/DNA complex; complexed with ni; mutant

Details for d2tdxa1

PDB Entry: 2tdx (more details), 2.4 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel
PDB Compounds: (A:) diphtheria tox repressor

SCOPe Domain Sequences for d2tdxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tdxa1 a.4.5.24 (A:1-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
slqm

SCOPe Domain Coordinates for d2tdxa1:

Click to download the PDB-style file with coordinates for d2tdxa1.
(The format of our PDB-style files is described here.)

Timeline for d2tdxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2tdxa2