Lineage for d1wx1b_ (1wx1 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114880Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567
  4. 2114881Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families) (S)
  5. 2114882Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 protein domains)
    automatically mapped to Pfam PF02277
  6. 2114915Protein automated matches [190818] (3 species)
    not a true protein
  7. 2114924Species Thermus thermophilus HB8 [TaxId:300852] [188100] (1 PDB entry)
  8. 2114926Domain d1wx1b_: 1wx1 B: [162007]
    automated match to d1j33a_
    complexed with na

Details for d1wx1b_

PDB Entry: 1wx1 (more details), 1.97 Å

PDB Description: Crystal structure of nictinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase from Thermus thermophilus HB8
PDB Compounds: (B:) Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

SCOPe Domain Sequences for d1wx1b_:

Sequence, based on SEQRES records: (download)

>d1wx1b_ c.39.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mdpevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvva
egvsaypqevtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrp
gtanlaqgpamtpeeaerallagreaarraiaegatllaagdmgignttaaaaltaallg
lppeavvgrgtgvgeeglrrkrqavaralarlhpgmgplevaaevgglelvaiagiyleg
yeaglplvldgfpvtagallawkmapglrdhlfaghlsrepghrhqlealglrplldldl
algegtgavlampllraaarilhmatfqeagvsrg

Sequence, based on observed residues (ATOM records): (download)

>d1wx1b_ c.39.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mdpevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvva
egvsaypqevtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrp
gtanlaqgpamtpeeaerallagreaarraiaegatllaagdmgignttaaaaltaallg
lppeavvggeeglrrkrqavaralarlhpgmgplevaaevgglelvaiagiylegyeagl
plvldgfpvtagallawkmapglrdhlfaghlsrepghrhqlealglrplldldlalgeg
tgavlampllraaarilhmatfqeagvsrg

SCOPe Domain Coordinates for d1wx1b_:

Click to download the PDB-style file with coordinates for d1wx1b_.
(The format of our PDB-style files is described here.)

Timeline for d1wx1b_: