Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.15: KaiB-like [102449] (3 proteins) Pfam PF07689; contains members with alternative folds |
Protein automated matches [190797] (3 species) not a true protein |
Species Synechocystis sp. [TaxId:1143] [188099] (1 PDB entry) |
Domain d1wwjc_: 1wwj C: [162004] automated match to d1r5pb_ complexed with bet, imd, mlt |
PDB Entry: 1wwj (more details), 1.9 Å
SCOPe Domain Sequences for d1wwjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwjc_ c.47.1.15 (C:) automated matches {Synechocystis sp. [TaxId: 1143]} mspfkktyvlklyvagntpnsvralkmlknileqefqgvyalkvidvlknpqlaeedkil atptlakilpppvrkiigdlsdrekvligldllydeir
Timeline for d1wwjc_: