Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.256: Ta1353-like [103164] (1 superfamily) core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423; |
Superfamily d.256.1: Ta1353-like [103165] (2 families) |
Family d.256.1.0: automated matches [191419] (1 protein) not a true family |
Protein automated matches [190589] (4 species) not a true protein |
Species Pyrobaculum aerophilum [TaxId:13773] [188096] (2 PDB entries) |
Domain d1wvqb_: 1wvq B: [162000] automated match to d1vgga_ complexed with po4 |
PDB Entry: 1wvq (more details), 1.45 Å
SCOPe Domain Sequences for d1wvqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvqb_ d.256.1.0 (B:) automated matches {Pyrobaculum aerophilum [TaxId: 13773]} sikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrhe andeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkviv aeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
Timeline for d1wvqb_: