Lineage for d1wvqb_ (1wvq B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008980Fold d.256: Ta1353-like [103164] (1 superfamily)
    core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;
  4. 3008981Superfamily d.256.1: Ta1353-like [103165] (2 families) (S)
  5. 3008994Family d.256.1.0: automated matches [191419] (1 protein)
    not a true family
  6. 3008995Protein automated matches [190589] (4 species)
    not a true protein
  7. 3008996Species Pyrobaculum aerophilum [TaxId:13773] [188096] (2 PDB entries)
  8. 3008998Domain d1wvqb_: 1wvq B: [162000]
    automated match to d1vgga_
    complexed with po4

Details for d1wvqb_

PDB Entry: 1wvq (more details), 1.45 Å

PDB Description: Structure of conserved hypothetical protein PAE2307 from Pyrobaculum aerophilum
PDB Compounds: (B:) hypothetical protein pae2307

SCOPe Domain Sequences for d1wvqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvqb_ d.256.1.0 (B:) automated matches {Pyrobaculum aerophilum [TaxId: 13773]}
sikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrhe
andeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkviv
aeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl

SCOPe Domain Coordinates for d1wvqb_:

Click to download the PDB-style file with coordinates for d1wvqb_.
(The format of our PDB-style files is described here.)

Timeline for d1wvqb_: