Lineage for d1wuvd_ (1wuv D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2778956Species Canavalia gladiata [TaxId:3824] [187610] (5 PDB entries)
  8. 2778959Domain d1wuvd_: 1wuv D: [161994]
    automated match to d1azda_
    complexed with ca, mn

Details for d1wuvd_

PDB Entry: 1wuv (more details), 2.3 Å

PDB Description: Crystal structure of native Canavalia gladiata lectin (CGL): a tetrameric ConA-like lectin
PDB Compounds: (D:) concanavalin a

SCOPe Domain Sequences for d1wuvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuvd_ b.29.1.1 (D:) automated matches {Canavalia gladiata [TaxId: 3824]}
adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1wuvd_:

Click to download the PDB-style file with coordinates for d1wuvd_.
(The format of our PDB-style files is described here.)

Timeline for d1wuvd_: