SCOPe 2.02: Domain d1wuod_: 1wuo D:

Lineage for d1wuod_ (1wuo D:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (11 species)

7. Species Serratia marcescens [TaxId:615] [190018] (2 PDB entries)

8. Domain d1wuod_: 1wuo D: [161992]
   automated match to d1jjeb_
   complexed with acy, zn; mutant

Details for d1wuod_

PDB Entry: 1wuo, 2.01 Å

PDB Description: Crystal structure of metallo-beta-lactamase IMP-1 mutant (D81A)

PDB Compounds: (D:) beta-lactamase imp-1

SCOPe Domain Sequences for d1wuod_:

Sequence; same for both SEQRES and ATOM records:

>d1wuod_ d.157.1.1 (D:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglnesk

Timeline for d1wuod_:

• d1wuod_ first appeared in SCOPe 2.01
  
• d1wuod_ appears in SCOPe 2.03
  
• d1wuod_ appears in the current release, SCOPe 2.08