Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein Zn metallo-beta-lactamase [56283] (11 species) |
Species Serratia marcescens [TaxId:615] [190018] (2 PDB entries) |
Domain d1wuod_: 1wuo D: [161992] automated match to d1jjeb_ complexed with acy, zn; mutant |
PDB Entry: 1wuo (more details), 2.01 Å
SCOPe Domain Sequences for d1wuod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuod_ d.157.1.1 (D:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]} slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw fvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl lkskygkaklvvpshsevgdasllkltleqavkglnesk
Timeline for d1wuod_: