Lineage for d1wuod_ (1wuo D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555488Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2555489Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2555596Species Serratia marcescens [TaxId:615] [190018] (8 PDB entries)
  8. 2555604Domain d1wuod_: 1wuo D: [161992]
    automated match to d1jjeb_
    complexed with acy, zn; mutant

Details for d1wuod_

PDB Entry: 1wuo (more details), 2.01 Å

PDB Description: Crystal structure of metallo-beta-lactamase IMP-1 mutant (D81A)
PDB Compounds: (D:) beta-lactamase imp-1

SCOPe Domain Sequences for d1wuod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuod_ d.157.1.1 (D:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglnesk

SCOPe Domain Coordinates for d1wuod_:

Click to download the PDB-style file with coordinates for d1wuod_.
(The format of our PDB-style files is described here.)

Timeline for d1wuod_: