SCOPe 2.06: Domain d1wuoc_: 1wuo C:

Lineage for d1wuoc_ (1wuo C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (12 species)

7. Species Serratia marcescens [TaxId:615] [190018] (5 PDB entries)

8. Domain d1wuoc_: 1wuo C: [161991]
   automated match to d1jjeb_
   complexed with acy, zn; mutant

Details for d1wuoc_

PDB Entry: 1wuo, 2.01 Å

PDB Description: Crystal structure of metallo-beta-lactamase IMP-1 mutant (D81A)

PDB Compounds: (C:) beta-lactamase imp-1

SCOPe Domain Sequences for d1wuoc_:

Sequence; same for both SEQRES and ATOM records:

>d1wuoc_ d.157.1.1 (C:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglnesk

Timeline for d1wuoc_:

• d1wuoc_ first appeared in SCOPe 2.01
  
• d1wuoc_ appears in SCOPe 2.05
  
• d1wuoc_ appears in SCOPe 2.07
  
• d1wuoc_ appears in the current release, SCOPe 2.08