Lineage for d1wuoc_ (1wuo C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231218Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2231326Species Serratia marcescens [TaxId:615] [190018] (5 PDB entries)
  8. 2231333Domain d1wuoc_: 1wuo C: [161991]
    automated match to d1jjeb_
    complexed with acy, zn; mutant

Details for d1wuoc_

PDB Entry: 1wuo (more details), 2.01 Å

PDB Description: Crystal structure of metallo-beta-lactamase IMP-1 mutant (D81A)
PDB Compounds: (C:) beta-lactamase imp-1

SCOPe Domain Sequences for d1wuoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuoc_ d.157.1.1 (C:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglnesk

SCOPe Domain Coordinates for d1wuoc_:

Click to download the PDB-style file with coordinates for d1wuoc_.
(The format of our PDB-style files is described here.)

Timeline for d1wuoc_: