Lineage for d1wtwa_ (1wtw A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394631Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)
  6. 2394652Protein automated matches [190114] (2 species)
    not a true protein
  7. 2394653Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries)
  8. 2394666Domain d1wtwa_: 1wtw A: [161987]
    automated match to d1azpa_
    protein/DNA complex; mutant

Details for d1wtwa_

PDB Entry: 1wtw (more details), 2.2 Å

PDB Description: hyperthermophile chromosomal protein sac7d single mutant v26a in complex with dna gcgatcgc
PDB Compounds: (A:) DNA-binding proteins 7a/7b/7d

SCOPe Domain Sequences for d1wtwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtwa_ b.34.13.1 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
mvkvkfkykgeekevdtskikkvwragkmvsftyddngktgrgavsekdapkelldmlar
aerekk

SCOPe Domain Coordinates for d1wtwa_:

Click to download the PDB-style file with coordinates for d1wtwa_.
(The format of our PDB-style files is described here.)

Timeline for d1wtwa_: