Lineage for d1wtra_ (1wtr A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055542Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2055543Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)
  6. 2055564Protein automated matches [190114] (2 species)
    not a true protein
  7. 2055565Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries)
  8. 2055574Domain d1wtra_: 1wtr A: [161985]
    automated match to d1azpa_
    protein/DNA complex; mutant

Details for d1wtra_

PDB Entry: 1wtr (more details), 1.8 Å

PDB Description: hyperthermophile chromosomal protein sac7d single mutant m29a in complex with dna gcgatcgc
PDB Compounds: (A:) DNA-binding proteins 7a/7b/7d

SCOPe Domain Sequences for d1wtra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtra_ b.34.13.1 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
mvkvkfkykgeekevdtskikkvwrvgkavsftyddngktgrgavsekdapkelldmlar
aerekk

SCOPe Domain Coordinates for d1wtra_:

Click to download the PDB-style file with coordinates for d1wtra_.
(The format of our PDB-style files is described here.)

Timeline for d1wtra_: