![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins) |
![]() | Protein automated matches [190114] (1 species) not a true protein |
![]() | Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (9 PDB entries) |
![]() | Domain d1wtra_: 1wtr A: [161985] automated match to d1azpa_ protein/DNA complex; mutant |
PDB Entry: 1wtr (more details), 1.8 Å
SCOPe Domain Sequences for d1wtra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wtra_ b.34.13.1 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]} mvkvkfkykgeekevdtskikkvwrvgkavsftyddngktgrgavsekdapkelldmlar aerekk
Timeline for d1wtra_: