SCOPe 2.05: Domain d1wtoa_: 1wto A:

Lineage for d1wtoa_ (1wto A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)

6. Protein automated matches [190114] (1 species)
   not a true protein

7. Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries)

8. Domain d1wtoa_: 1wto A: [161981]
   automated match to d1azpa_
   protein/DNA complex; mutant

Details for d1wtoa_

PDB Entry: 1wto, 1.5 Å

PDB Description: hyperthermophile chromosomal protein sac7d double mutant v26f/m29f in complex with dna gcgatcgc

PDB Compounds: (A:) DNA-binding proteins 7a/7b/7d

SCOPe Domain Sequences for d1wtoa_:

Sequence; same for both SEQRES and ATOM records:

>d1wtoa_ b.34.13.1 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
vkvkfkykgeekevdtskikkvwrfgkfvsftyddngktgrgavsekdapkelldmlara
erekk

Timeline for d1wtoa_:

• d1wtoa_ first appeared in SCOPe 2.01
  
• d1wtoa_ appears in SCOPe 2.04
  
• d1wtoa_ appears in SCOPe 2.06
  
• d1wtoa_ appears in the current release, SCOPe 2.08