SCOPe 2.01: Domain d1wtaa_: 1wta A:

Lineage for d1wtaa_ (1wta A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (12 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:272557] [188092] (1 PDB entry)

8. Domain d1wtaa_: 1wta A: [161980]
   automated match to d1v4nb_
   complexed with ade, po4

Details for d1wtaa_

PDB Entry: 1wta, 1.78 Å

PDB Description: crystal structure of 5'-deoxy-5'-methylthioadenosine from aeropyrum pernix (r32 form)

PDB Compounds: (A:) 5'-methylthioadenosine phosphorylase

SCOPe Domain Sequences for d1wtaa_:

Sequence; same for both SEQRES and ATOM records:

>d1wtaa_ c.56.2.1 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
eitrppgvrahvgviggsglydpgivenpvevkvstpygnpsdfivvgdvagvkvaflpr
hgrghripphainyraniwalkalgvkwvisvsavgslredyrpgdfvvpdqfidmtknr
rhytfydgpvtvhvsmadpfcedlrqrlidsgrrlgytvhergtyvciegprfstraesr
vwkdvfkadiigmtlvpeinlaceaqlcyatlamvtdydvwadrpvtaeevervmisnve
rarrmlydvipklagepelercsccraldtaai

Timeline for d1wtaa_:

• d1wtaa_ is new in SCOPe 2.01-stable
  
• d1wtaa_ appears in SCOPe 2.02
  
• d1wtaa_ appears in the current release, SCOPe 2.08