Lineage for d1wtaa_ (1wta A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 997377Protein automated matches [190142] (12 species)
    not a true protein
  7. 997378Species Aeropyrum pernix [TaxId:272557] [188092] (1 PDB entry)
  8. 997379Domain d1wtaa_: 1wta A: [161980]
    automated match to d1v4nb_
    complexed with ade, po4

Details for d1wtaa_

PDB Entry: 1wta (more details), 1.78 Å

PDB Description: crystal structure of 5'-deoxy-5'-methylthioadenosine from aeropyrum pernix (r32 form)
PDB Compounds: (A:) 5'-methylthioadenosine phosphorylase

SCOPe Domain Sequences for d1wtaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtaa_ c.56.2.1 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
eitrppgvrahvgviggsglydpgivenpvevkvstpygnpsdfivvgdvagvkvaflpr
hgrghripphainyraniwalkalgvkwvisvsavgslredyrpgdfvvpdqfidmtknr
rhytfydgpvtvhvsmadpfcedlrqrlidsgrrlgytvhergtyvciegprfstraesr
vwkdvfkadiigmtlvpeinlaceaqlcyatlamvtdydvwadrpvtaeevervmisnve
rarrmlydvipklagepelercsccraldtaai

SCOPe Domain Coordinates for d1wtaa_:

Click to download the PDB-style file with coordinates for d1wtaa_.
(The format of our PDB-style files is described here.)

Timeline for d1wtaa_: