| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
| Protein Diphtheria toxin repressor (DtxR) [46883] (1 species) |
| Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries) Uniprot P33120 |
| Domain d1bi2b1: 1bi2 B:3-64 [16198] Other proteins in same PDB: d1bi2a2, d1bi2a3, d1bi2b2 |
PDB Entry: 1bi2 (more details), 2.3 Å
SCOPe Domain Sequences for d1bi2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bi2b1 a.4.5.24 (B:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm
Timeline for d1bi2b1: