Lineage for d1wola_ (1wol A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700508Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) (S)
  5. 2700577Family a.24.16.0: automated matches [191498] (1 protein)
    not a true family
  6. 2700578Protein automated matches [190812] (1 species)
    not a true protein
  7. 2700579Species Sulfolobus tokodaii [TaxId:273063] [188084] (1 PDB entry)
  8. 2700580Domain d1wola_: 1wol A: [161974]
    automated match to d1o3ua_
    complexed with tbu

Details for d1wola_

PDB Entry: 1wol (more details), 1.62 Å

PDB Description: Crystal Structure of ST0689, an archaeal HEPN homologue
PDB Compounds: (A:) 122aa long conserved hypothetical protein

SCOPe Domain Sequences for d1wola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wola_ a.24.16.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mkrvedwikqaerdleearyaksggyyelacflsqqcaekavkgllqfqgiekrghsish
lltnppadilqcatfldkqytpsrypdvyyegapyeyyterdadecincairilnwvkgq
ik

SCOPe Domain Coordinates for d1wola_:

Click to download the PDB-style file with coordinates for d1wola_.
(The format of our PDB-style files is described here.)

Timeline for d1wola_: