| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) ![]() |
| Family a.24.16.0: automated matches [191498] (1 protein) not a true family |
| Protein automated matches [190812] (1 species) not a true protein |
| Species Sulfolobus tokodaii [TaxId:273063] [188084] (1 PDB entry) |
| Domain d1wola_: 1wol A: [161974] automated match to d1o3ua_ complexed with tbu |
PDB Entry: 1wol (more details), 1.62 Å
SCOPe Domain Sequences for d1wola_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wola_ a.24.16.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mkrvedwikqaerdleearyaksggyyelacflsqqcaekavkgllqfqgiekrghsish
lltnppadilqcatfldkqytpsrypdvyyegapyeyyterdadecincairilnwvkgq
ik
Timeline for d1wola_: